MView

MView is a command line utility that extracts and reformats the results of a sequence database search or a multiple alignment, optionally adding HTML markup for web page layout. It can also be used as a filter to extract and convert searches or alignments to common formats.

                                1 [        .         .         .         .         :         .         .         ] 80
1 sp|P00533.2|EGFR_HUMAN  100.0%    FKKIKVLGSGAFGTVYKGLWIPEGEK---------VKIPVAIKELREATSPK-ANKEILDEAYVMASVDNPHVCRLLGIC
2 sp|Q9I7F7.3|PR2_DROME    35.7%    ISVNKQLGTGEFGIVQQGVWSNGNE-----------RIQVAIKCLCRERMQS-NPMEFLKEAAIMHSIEHENIVRLYGVV
3 sp|Q08881.1|ITK_HUMAN    32.9%    LTFVQEIGSGQFGLVHLGYWLN--------------KDKVAIKTIREGAMS---EEDFIEEAEVMMKLSHPKLVQLYGVC
4 sp|Q13308.2|PTK7_HUMAN   21.2%    IREVKQIGVGQFGAVVLAEMTGLS-XLPKGSMNADGVALVAVKKLKPDVSD-EVLQSFDKEIKFMSQLQHDSIVQLLAIC
5 sp|P34265.4|KIN31_CAEEL  31.5%    VELTKKLGEGAFGEVWKGKLLKILDA-------NHQPVLVAVKTAKLESMTKEQIKEIMREARLMRNLDHINVVKFFGVA
  consensus/90%                     .......G.G.FG.V........................VA.K.................E...M...............
  consensus/80%                     ....K..G.G.FG.V..G.....................VA.K.................EA..M....H...V.L.G..

Inputs:

  • Sequence database search: BLAST, FASTA suites.
  • Multiple sequence alignment: CLUSTAL, HSSP, MSF, FASTA, PIR, MAF.

Outputs:

  • HTML, FASTA, CLUSTAL, MSF, PIR, RDB (tab-separated).

Download

The latest release of the software on GitHub can be downloaded by clicking on the ‘releases’ tab then selecting a version and archive format (zip or tar.gz).

A snapshot of the (possibly unstable) development code can be downloaded using the ‘Download ZIP’ button on the main page.

Tarballs and bzip2 archives of releases can also be found at the older SourceForge archive.

Found a bug?

Please send an email to biomview _at_ gmail.com.

If MView isn’t able to parse your input file or produces a warning message, it would be very helpful if you can include/attach the data file in your email so that I can (1) quickly reproduce the error, and (2) add the example to the test suite.

Citation

If you use MView in your work, please cite:

Brown, N.P., Leroy C., Sander C. (1998). MView: A Web compatible database search or multiple alignment viewer. Bioinformatics. 14 (4):380-381. [PubMed]